Product Overview
Antibody sequencing currently employs a bottom-up proteomics strategy, using various protease digestion combinations to hydrolyze antibodies/proteins into peptides. Then, high-sensitivity and high-resolution mass spectrometry is used to acquire MS/MS secondary mass spectra of these peptides. De novo analysis of the amino acid sequences of these peptide MS/MS spectra is performed using software, and then the sequences are further stacked and assembled into the full-length protein sequence.
Service Features
(1) High accuracy, guaranteeing sequencing activity; the success rate of sequencing hundreds of antibodies annually reaches 98%;
(2) Low requirement for sample purity; purity above 50% is sufficient, and sequencing of mixed monoclonal antibodies is also possible;
(3) High sensitivity; sample volume is generally 20-100ug, and Wininnovate Bio can sequence proteins or antibodies down to 1-5ug, allowing for protein separation and sequencing from kits;
(4) Fast: generally 5-10 working days, with delivery as fast as 2 working days;
(5) Relatively low price;
(6) Does not distinguish between antibody types such as IgG and IgM, or mouse, rabbit, chicken, nanobodies, or modified antibody species;
(7) Charges are based on the total number of antibody sequences delivered, with thorough pre-sales communication and respect for customer needs and opinions;
(8) Worry-free after-sales service; up to two free retesting services or refunds are provided to ensure customers receive completely accurate sequence information.
Technical Process
Figure 1. Antibody sequencing flowchart
Key Deliverables
> A001 ligth chain
QIVLTQSPAIMSASPGEKVTMTCSASSSVSFMHWYQQKSGTSPKRWIYATSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNTPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC.
>A001 heavy chain
EVQLQQSGPELVKPGTSMKISCKASGYSFTDYTMNWVKQSHGKNLEWIGLINPYNGGTSYNQKFKGKATLTVDKSSTTAYMELLSLTSEDSAVYYCARRGDRYDNYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK.
Figure 2. Molecular mass of intact N-glycan light and heavy chains cleaved by antibody
Figure 3. Amino acid sequence coverage diagram
Figure 4. Amino acid distinction table between leucine and isoleucine
Shenzhen Wininnovate Bio Co., Ltd.
Innovative mass spectrometry and AI technologies provide protein and metabolite mass spectrometry multi-omics solutions for life science research, empowering the growth of the biotechnology, pharmaceutical, and healthcare industries.
